PNMA3 antibody (N-Term)

Catalog No. ABIN630623

Product Details anti-PNMA3 Antibody

Target: PNMA3 (Paraneoplastic Antigen MA3 (PNMA3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PNMA3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PNMA3 antibody was raised against the N terminal of PNMA3

Purification: Affinity purified

Immunogen: PNMA3 antibody was raised using the N terminal of PNMA3 corresponding to a region with amino acids QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PNMA3 Blocking Peptide, catalog no. 33R-7501, is also available for use as a blocking control in assays to test for specificity of this PNMA3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNMA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PNMA3

Target: PNMA3 (Paraneoplastic Antigen MA3 (PNMA3))

Alternative Name: PNMA3 (PNMA3 Products)

Synonyms: MA3 antibody, MA5 antibody, RGD1563752 antibody, PNMA family member 3 antibody, paraneoplastic antigen MA3 antibody, paraneoplastic Ma antigen 3 antibody, PNMA3 antibody, Pnma3 antibody

Background: This gene is a member of the paraneoplastic antigen MA (PNMA) gene family, whose protein products share homology with retroviral Gag proteins. They are highly expressed in the brain and also in a range of tumors associated with serious neurological phenotypes. PMID:16407312 reports the presence of a functional -1 ribosomal frameshift signal (consisting of a heptanucleotide shift motif followed 3' by a pseudoknot structure) in this gene, however, the frame-shifted product has not been characterized.

Molecular Weight: 52 kDa (MW of target protein)