MVP antibody (N-Term)

Catalog No. ABIN630625

Product Details anti-MVP Antibody

Target: MVP (Major Vault Protein (MVP))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MVP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MVP antibody was raised against the N terminal of MVP

Purification: Affinity purified

Immunogen: MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MVP Blocking Peptide, catalog no. 33R-5769, is also available for use as a blocking control in assays to test for specificity of this MVP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MVP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MVP

Target: MVP (Major Vault Protein (MVP))

Alternative Name: MVP (MVP Products)

Synonyms: LRP antibody, VAULT1 antibody, 2310009M24Rik antibody, cb771 antibody, wu:fb52b05 antibody, wu:fc02g01 antibody, mvp antibody, MGC145641 antibody, Tb05.45E22.810 antibody, major vault protein antibody, major vault protein L homeolog antibody, putative major vault protein antibody, MVP antibody, Mvp antibody, mvp antibody, mvp.L antibody, Tc00.1047053510353.10 antibody, Tb927.5.4460 antibody, Tb10.70.0520 antibody, Tb10.70.5840 antibody, LMJF_05_0060 antibody

Background: MVP is required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. MVP down-regulates INFG-mediated STAT1 signaling and subsequent activation of JAK. MVP down-regulates SRC activity and signaling through MAP kinases.

Molecular Weight: 98 kDa (MW of target protein)