FTSJ1 antibody

Catalog No. ABIN630633

The Rabbit Polyclonal anti-FTSJ1 antibody (ABIN630633) specifically detects FTSJ1 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for FTSJ1 antibody (ABIN630633)

Target: FTSJ1 (FtsJ RNA Methyltransferase Homolog 1 (FTSJ1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FTSJ1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FTSJ1 Antibody

Purification: Affinity purified

Immunogen: FTSJ1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FTSJ1 Blocking Peptide, (ABIN5613651), is also available for use as a blocking control in assays to test for specificity of this FTSJ1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTSJ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FTSJ1

Target: FTSJ1 (FtsJ RNA Methyltransferase Homolog 1 (FTSJ1))

Alternative Name: FTSJ1

Background: FTSJ1 is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA.

Molecular Weight: 36 kDa (MW of target protein)