CK1 epsilon antibody (N-Term)

Catalog No. ABIN630641

Product Details anti-CK1 epsilon Antibody

Target: CK1 epsilon (CSNK1E) (Casein Kinase 1, epsilon (CSNK1E))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CK1 epsilon antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CK1 epsilon antibody was raised against the N terminal of CSNK1 E

Purification: Affinity purified

Immunogen: CK1 epsilon antibody was raised using the N terminal of CSNK1 E corresponding to a region with amino acids MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CK1 epsilon Blocking Peptide, catalog no. 33R-5936, is also available for use as a blocking control in assays to test for specificity of this CK1 epsilon antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CK1 epsilon

Target: CK1 epsilon (CSNK1E) (Casein Kinase 1, epsilon (CSNK1E))

Alternative Name: CK1 epsilon (CSNK1E Products)

Synonyms: CKIepsilon antibody, HCKIE antibody, CKIe antibody, ck1-epsilon antibody, ck1epsilon antibody, hckie antibody, dco antibody, fj38c01 antibody, wu:fj38c01 antibody, wu:fj62a04 antibody, zgc:77310 antibody, AI426939 antibody, AI551861 antibody, AW457082 antibody, CK1epsilon antibody, KC1epsilon antibody, tau antibody, ckie antibody, CSNK1E antibody, Csnk1e antibody, CKI-epsilon antibody, 0538/13 antibody, 0915/10 antibody, 1396/02 antibody, 1447/01 antibody, 1460/09 antibody, CG2048 antibody, CK1delta/epsilon antibody, DBT antibody, DBT/CK1epsilon antibody, DCO antibody, DCO/CKIe antibody, Dbt antibody, Dco antibody, Dco/CK1 antibody, Dmel\CG2048 antibody, dCKIepsilon antibody, dbt antibody, dco-1 antibody, ddbt antibody, l(3)S053813 antibody, l(3)S144701 antibody, l(3)dco antibody, l(3)dco-1 antibody, l(3)discs overgrown antibody, l(3)discs overgrown-1 antibody, l(3)j3B9 antibody, l(3)rK215 antibody, casein kinase 1 epsilon antibody, casein kinase 1, epsilon antibody, casein kinase 1 epsilon L homeolog antibody, casein kinase I isoform epsilon antibody, casein kinase I epsilon antibody, casein kinase I antibody, LOC400927-CSNK1E readthrough antibody, discs overgrown antibody, CSNK1E antibody, csnk1e antibody, Csnk1e antibody, csnk1e.L antibody, LOC443240 antibody, NAEGRDRAFT_82890 antibody, LOC100407384 antibody, LOC100523244 antibody, LOC100607246 antibody, LOC100727500 antibody, LOC400927-CSNK1E antibody, dco antibody

Background: Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1E can phosphorylate a large number of proteins. CSNK1E participates in Wnt signaling and is the central component of the circadian clock. It may act as a negative regulator of circadian rhythmicity by phosphorylating PER1 and PER2. CSNK1E inhibits cytokine-induced granuloytic differentiation.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Hedgehog Signaling, M Phase