KPNA5 antibody

Catalog No. ABIN630665

The Rabbit Polyclonal anti-KPNA5 antibody is suitable to detect KPNA5 in samples from Human. It has been validated for WB.

Quick Overview for KPNA5 antibody (ABIN630665)

Target: KPNA5 (Karyopherin alpha 5 (Importin alpha 6) (KPNA5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KPNA5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KPNA5 Antibody

Purification: Affinity purified

Immunogen: Karyopherin Alpha 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Karyopherin Alpha 5 Blocking Peptide, (ABIN5614254), is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KPNA5

Target: KPNA5 (Karyopherin alpha 5 (Importin alpha 6) (KPNA5))

Alternative Name: Karyopherin alpha 5

Background: The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kDa) can pass through the nuclear pore by nonselective diffusion, larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus