PDE7B antibody (Middle Region)

Catalog No. ABIN630666

Product Details anti-PDE7B Antibody

Target: PDE7B (phosphodiesterase 7B (PDE7B))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDE7B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PDE7 B antibody was raised against the middle region of PDE7

Purification: Affinity purified

Immunogen: PDE7 B antibody was raised using the middle region of PDE7 corresponding to a region with amino acids IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDE7B Blocking Peptide, catalog no. 33R-3973, is also available for use as a blocking control in assays to test for specificity of this PDE7B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDE7B

Target: PDE7B (phosphodiesterase 7B (PDE7B))

Alternative Name: PDE7B (PDE7B Products)

Synonyms: PDE7B antibody, ba472e5.1 antibody, bA472E5.1 antibody, phosphodiesterase 7B antibody, PDE7B antibody, pde7b antibody, Pde7b antibody

Background: The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: cAMP Metabolic Process