MSL2 antibody

Catalog No. ABIN630673

This Rabbit Polyclonal antibody specifically detects MSL2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for MSL2 antibody (ABIN630673)

Target: MSL2 (Male-Specific Lethal 2 Homolog (MSL2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MSL2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MSL2 Antibody

Purification: Affinity purified

Immunogen: MSL2 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MSL2L1 Blocking Peptide, (ABIN5614854), is also available for use as a blocking control in assays to test for specificity of this MSL2L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSL0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MSL2

Target: MSL2 (Male-Specific Lethal 2 Homolog (MSL2))

Alternative Name: MSL2L1

Background: MSL2L1 is the component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at lysine 16 which is implicated in the formation of higher-order chromatin structure.

Molecular Weight: 62 kDa (MW of target protein)