Actl7b antibody (Middle Region)

Catalog No. ABIN630675

Product Details anti-Actl7b Antibody

Target: Actl7b (Actin-Like 7b (Actl7b))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Actl7b antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACTL7 B antibody was raised against the middle region of ACTL7

Purification: Affinity purified

Immunogen: ACTL7 B antibody was raised using the middle region of ACTL7 corresponding to a region with amino acids KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACTL7B Blocking Peptide, catalog no. 33R-4511, is also available for use as a blocking control in assays to test for specificity of this ACTL7B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Actl7b

Target: Actl7b (Actin-Like 7b (Actl7b))

Alternative Name: ACTL7B (Actl7b Products)

Synonyms: ACTL7B antibody, Tact1 antibody, actin-like 7b antibody, actin like 7B antibody, Actl7b antibody, ACTL7B antibody

Background: ACTL7B is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.

Molecular Weight: 46 kDa (MW of target protein)