SETDB2 antibody (N-Term)

Catalog No. ABIN630677

The Rabbit Polyclonal anti-SETDB2 antibody has been validated for WB. It is suitable to detect SETDB2 in samples from Human.

Quick Overview for SETDB2 antibody (N-Term) (ABIN630677)

Target: SETDB2 (SET Domain, Bifurcated 2 (SETDB2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SETDB2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SETDB2 Antibody

Binding Specificity: N-Term

Specificity: SETDB2 antibody was raised against the N terminal of SETDB2

Purification: Affinity purified

Immunogen: SETDB2 antibody was raised using the N terminal of SETDB2 corresponding to a region with amino acids ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SETDB2 Blocking Peptide, (ABIN936909), is also available for use as a blocking control in assays to test for specificity of this SETDB2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SETDB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SETDB2

Target: SETDB2 (SET Domain, Bifurcated 2 (SETDB2))

Alternative Name: SETDB2

Background: Proteins that contain a SET domain, such as SETDB2, modulate gene expression epigenetically through histone H3 methylation. SETDB2 is likely a histone H3 methyltransferase, as it contains both the active site and flanking cysteine residues required for catalytic activity.

Molecular Weight: 77 kDa (MW of target protein)