FBXL3 antibody (Middle Region)

Catalog No. ABIN630702

Product Details anti-FBXL3 Antibody

Target: FBXL3 (F-Box and Leucine-Rich Repeat Protein 3 (FBXL3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXL3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXL3 antibody was raised against the middle region of FBXL3

Purification: Affinity purified

Immunogen: FBXL3 antibody was raised using the middle region of FBXL3 corresponding to a region with amino acids LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXL3 Blocking Peptide, catalog no. 33R-5067, is also available for use as a blocking control in assays to test for specificity of this FBXL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXL3

Target: FBXL3 (F-Box and Leucine-Rich Repeat Protein 3 (FBXL3))

Alternative Name: FBXL3 (FBXL3 Products)

Synonyms: FBL3 antibody, FBL3A antibody, FBXL3A antibody, AU041772 antibody, AW212966 antibody, FBK antibody, Fbl3a antibody, Fbxl3a antibody, Ovtm antibody, Play68 antibody, fbxl3 antibody, FBXL3 antibody, F7A7.240 antibody, F7A7_240 antibody, im:7153024 antibody, zgc:103721 antibody, F-box and leucine rich repeat protein 3 antibody, F-box and leucine-rich repeat protein 3 antibody, F-box and leucine-rich repeat protein 3 L homeolog antibody, RNI-like superfamily protein antibody, F-box and leucine-rich repeat protein 3a antibody, FBXL3 antibody, Fbxl3 antibody, fbxl3.L antibody, fbxl3 antibody, AT5G01720 antibody, fbxl3a antibody

Background: FBXL3 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats and is localized in the nucleus.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Photoperiodism