ITGB1BP3 antibody (Middle Region)

Catalog No. ABIN630714

Product Details anti-ITGB1BP3 Antibody

Target: ITGB1BP3 (Integrin beta 1 Binding Protein 3 (ITGB1BP3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ITGB1BP3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ITGB1 BP3 antibody was raised against the middle region of ITGB1 P3

Purification: Affinity purified

Immunogen: ITGB1 BP3 antibody was raised using the middle region of ITGB1 P3 corresponding to a region with amino acids YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ITGB1BP3 Blocking Peptide, catalog no. 33R-10154, is also available for use as a blocking control in assays to test for specificity of this ITGB1BP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB0 P3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ITGB1BP3

Target: ITGB1BP3 (Integrin beta 1 Binding Protein 3 (ITGB1BP3))

Alternative Name: ITGB1BP3 (ITGB1BP3 Products)

Synonyms: ITGB1BP3 antibody, MIBP antibody, NRK2 antibody, itgb1bp3 antibody, 2310015C21Rik antibody, Itgb1bp3 antibody, Mibp antibody, zgc:103408 antibody, nicotinamide riboside kinase 2 antibody, integrin beta 1 binding protein 3 antibody, nicotinamide riboside kinase 2 S homeolog antibody, NMRK2 antibody, ITGB1BP3 antibody, nmrk2.S antibody, nmrk2 antibody, Nmrk2 antibody

Background: ITGB1BP3 catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN).

Molecular Weight: 26 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development