RORC antibody (N-Term)

Catalog No. ABIN630715

Product Details anti-RORC Antibody

Target: RORC (RAR-Related Orphan Receptor C (RORC))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RORC antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RORC antibody was raised against the N terminal of RORC

Purification: Affinity purified

Immunogen: RORC antibody was raised using the N terminal of RORC corresponding to a region with amino acids EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RORC Blocking Peptide, catalog no. 33R-2655, is also available for use as a blocking control in assays to test for specificity of this RORC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RORC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RORC

Target: RORC (RAR-Related Orphan Receptor C (RORC))

Alternative Name: RORC (RORC Products)

Synonyms: NR1F3 antibody, RORG antibody, RZR-GAMMA antibody, RZRG antibody, TOR antibody, Nr1f3 antibody, RORgamma antibody, Thor antibody, RAR related orphan receptor C antibody, RAR-related orphan receptor C antibody, RAR-related orphan receptor gamma antibody, RORC antibody, Rorc antibody

Background: RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known, however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway