MLF1 antibody (N-Term)
-
- Target See all MLF1 Antibodies
- MLF1 (Myeloid Leukemia Factor 1 (MLF1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MLF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MLF1 antibody was raised against the N terminal of MLF1
- Purification
- Affinity purified
- Immunogen
- MLF1 antibody was raised using the N terminal of MLF1 corresponding to a region with amino acids GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQ
- Top Product
- Discover our top product MLF1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MLF1 Blocking Peptide, catalog no. 33R-3521, is also available for use as a blocking control in assays to test for specificity of this MLF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MLF1 (Myeloid Leukemia Factor 1 (MLF1))
- Alternative Name
- MLF1 (MLF1 Products)
- Background
- MLF1 is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. It interferes with erythopoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. MLF1 suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest.It binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus.
- Molecular Weight
- 29 kDa (MW of target protein)
-