MLF1 antibody (N-Term)

Catalog No. ABIN630719

Product Details anti-MLF1 Antibody

Target: MLF1 (Myeloid Leukemia Factor 1 (MLF1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MLF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MLF1 antibody was raised against the N terminal of MLF1

Purification: Affinity purified

Immunogen: MLF1 antibody was raised using the N terminal of MLF1 corresponding to a region with amino acids GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MLF1 Blocking Peptide, catalog no. 33R-3521, is also available for use as a blocking control in assays to test for specificity of this MLF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MLF1

Target: MLF1 (Myeloid Leukemia Factor 1 (MLF1))

Alternative Name: MLF1 (MLF1 Products)

Synonyms: MLF1 antibody, HLS7 antibody, myeloid leukemia factor 1 antibody, myeloid leukemia factor 1 L homeolog antibody, MLF1 antibody, mlf1.L antibody, mlf1 antibody, Mlf1 antibody

Background: MLF1 is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. It interferes with erythopoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. MLF1 suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest.It binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus.

Molecular Weight: 29 kDa (MW of target protein)