GGN antibody (N-Term)

Catalog No. ABIN630747

Product Details anti-GGN Antibody

Target: GGN (Gametogenetin (GGN))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GGN antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GGN antibody was raised against the N terminal of GGN

Purification: Affinity purified

Immunogen: GGN antibody was raised using the N terminal of GGN corresponding to a region with amino acids GPSKWQKPAGTPVPRIRRLLEASHRGQGDPPSLRPLKPPPPPRQLSVKDT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GGN Blocking Peptide, catalog no. 33R-3484, is also available for use as a blocking control in assays to test for specificity of this GGN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GGN

Target: GGN (Gametogenetin (GGN))

Alternative Name: GGN (GGN Products)

Synonyms: AI593290 antibody, gametogenetin antibody, GGN antibody, Ggn antibody

Background: GGN may be involved in spermatogenesis.

Molecular Weight: 67 kDa (MW of target protein)