CA1 antibody (N-Term)

Catalog No. ABIN630776

The Rabbit Polyclonal anti-CA1 antibody is suitable to detect CA1 in samples from Human. It has been validated for WB.

Quick Overview for CA1 antibody (N-Term) (ABIN630776)

Target: CA1 (Carbonic Anhydrase I (CA1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CA1 Antibody

Binding Specificity: N-Term

Specificity: Carbonic Anhydrase I antibody was raised against the N terminal of CA1

Purification: Affinity purified

Immunogen: Carbonic Anhydrase I antibody was raised using the N terminal of CA1 corresponding to a region with amino acids ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carbonic Anhydrase I Blocking Peptide, (ABIN936905), is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase I antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CA1

Target: CA1 (Carbonic Anhydrase I (CA1))

Alternative Name: Carbonic Anhydrase I

Background: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes.

Molecular Weight: 29 kDa (MW of target protein)