Nephronectin antibody (Middle Region)

Catalog No. ABIN630784

This Rabbit Polyclonal antibody specifically detects Nephronectin in WB. It exhibits reactivity toward Human, Mouse, Dog and Rat.

Quick Overview for Nephronectin antibody (Middle Region) (ABIN630784)

Target: Nephronectin (NPNT)

Reactivity: Human, Mouse, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Nephronectin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Nephronectin Antibody

Binding Specificity: Middle Region

Specificity: Nephronectin antibody was raised against the middle region of NPNT

Purification: Affinity purified

Immunogen: Nephronectin antibody was raised using the middle region of NPNT corresponding to a region with amino acids TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Nephronectin Blocking Peptide, (ABIN5614957), is also available for use as a blocking control in assays to test for specificity of this Nephronectin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPNT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Nephronectin

Target: Nephronectin (NPNT)

Alternative Name: Nephronectin

Background: NPNT is a functional ligand of integrin alpha-8/beta-1 in kidney development. It regulates with integrin alpha-8/beta-1 the expression of GDNF which is essential for kidney development. It may also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins.

Molecular Weight: 62 kDa (MW of target protein)