EPH Receptor A5 antibody (Middle Region)

Catalog No. ABIN630792

The Rabbit Polyclonal anti-EPH Receptor A5 antibody (ABIN630792) specifically detects EPH Receptor A5 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for EPH Receptor A5 antibody (Middle Region) (ABIN630792)

Target: EPH Receptor A5 (EPHA5)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EPH Receptor A5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EPH Receptor A5 Antibody

Binding Specificity: Middle Region

Specificity: Eph Receptor A5 antibody was raised against the middle region of EPHA5

Purification: Affinity purified

Immunogen: Eph Receptor A5 antibody was raised using the middle region of EPHA5 corresponding to a region with amino acids SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Eph Receptor A5 Blocking Peptide, (ABIN5613383), is also available for use as a blocking control in assays to test for specificity of this Eph Receptor A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPHA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EPH Receptor A5

Target: EPH Receptor A5 (EPHA5)

Alternative Name: Eph Receptor A5

Background: EPHA5 belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 114 kDa (MW of target protein)

Pathways: RTK Signaling