NEK7 antibody

Catalog No. ABIN630802

Product Details anti-NEK7 Antibody

Target: NEK7

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NEK7 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NEK7 antibody was raised using a synthetic peptide corresponding to a region with amino acids KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NEK7 Blocking Peptide, catalog no. 33R-4257, is also available for use as a blocking control in assays to test for specificity of this NEK7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NEK7

Target: NEK7

Alternative Name: NEK7 (NEK7 Products)

Synonyms: 2810460C19Rik antibody, AU020186 antibody, wu:fj68f02 antibody, zgc:100962 antibody, zgc:92175 antibody, AtNek7 antibody, NIMA-related kinase 7 antibody, NIMA (never in mitosis gene a)-related expressed kinase 7 antibody, NIMA-related kinase 7 antibody, NIMA related kinase 7 antibody, NIMA-related kinase 7 S homeolog antibody, Nek7 antibody, nek7 antibody, NEK7 antibody, nek7.S antibody

Background: NIMA-related kinases share high amino acid sequence identity with the gene product of the Aspergillus nidulans 'never in mitosis A' gene, which controls initiation of mitosis.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Inflammasome