PRKX antibody (N-Term)

Catalog No. ABIN630810

This anti-PRKX antibody is a Rabbit Polyclonal antibody detecting PRKX in WB. Suitable for Human.

Quick Overview for PRKX antibody (N-Term) (ABIN630810)

Target: PRKX (Protein Kinase, X-Linked (PRKX))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRKX antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PRKX Antibody

Binding Specificity: N-Term

Specificity: PRKX antibody was raised against the N terminal of PRKX

Purification: Affinity purified

Immunogen: PRKX antibody was raised using the N terminal of PRKX corresponding to a region with amino acids MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKX Blocking Peptide, (ABIN5615564), is also available for use as a blocking control in assays to test for specificity of this PRKX antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRKX

Target: PRKX (Protein Kinase, X-Linked (PRKX))

Alternative Name: PRKX

Background: This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis