ATE1 antibody (N-Term)
-
- Target See all ATE1 Antibodies
- ATE1 (Arginyltransferase 1 (ATE1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATE1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATE1 antibody was raised against the N terminal of ATE1
- Purification
- Affinity purified
- Immunogen
- ATE1 antibody was raised using the N terminal of ATE1 corresponding to a region with amino acids CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATE1 Blocking Peptide, catalog no. 33R-1654, is also available for use as a blocking control in assays to test for specificity of this ATE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATE1 (Arginyltransferase 1 (ATE1))
- Alternative Name
- ATE1 (ATE1 Products)
- Synonyms
- ATE1 antibody, Ate antibody, CG9204 antibody, Dm-Ate1 antibody, Dmel\\CG9204 antibody, ate1 antibody, l(2)k10809 antibody, zgc:158849 antibody, AI225793 antibody, AW547406 antibody, CG9204 gene product from transcript CG9204-RA antibody, arginyltransferase 1 antibody, arginyltransferase 1 L homeolog antibody, Ate1 antibody, ATE1 antibody, ate1 antibody, ate1.L antibody
- Background
- ATE1 is an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in two transcript variants encoding distinct isoforms.
- Molecular Weight
- 59 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome