Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

ATE1 antibody (N-Term)

ATE1 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN630829
$836.98
Plus shipping costs $45.00
100 μL
Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target See all ATE1 Antibodies
    ATE1 (Arginyltransferase 1 (ATE1))
    Binding Specificity
    • 5
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term
    Reactivity
    • 29
    • 5
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 1
    Human
    Host
    • 24
    • 5
    Rabbit
    Clonality
    • 25
    • 4
    Polyclonal
    Conjugate
    • 18
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This ATE1 antibody is un-conjugated
    Application
    • 16
    • 12
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Specificity
    ATE1 antibody was raised against the N terminal of ATE1
    Purification
    Affinity purified
    Immunogen
    ATE1 antibody was raised using the N terminal of ATE1 corresponding to a region with amino acids CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    ATE1 Blocking Peptide, catalog no. 33R-1654, is also available for use as a blocking control in assays to test for specificity of this ATE1 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATE1 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    ATE1 (Arginyltransferase 1 (ATE1))
    Alternative Name
    ATE1 (ATE1 Products)
    Synonyms
    ATE1 antibody, Ate antibody, CG9204 antibody, Dm-Ate1 antibody, Dmel\\CG9204 antibody, ate1 antibody, l(2)k10809 antibody, zgc:158849 antibody, AI225793 antibody, AW547406 antibody, CG9204 gene product from transcript CG9204-RA antibody, arginyltransferase 1 antibody, arginyltransferase 1 L homeolog antibody, Ate1 antibody, ATE1 antibody, ate1 antibody, ate1.L antibody
    Background
    ATE1 is an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in two transcript variants encoding distinct isoforms.
    Molecular Weight
    59 kDa (MW of target protein)
    Pathways
    SARS-CoV-2 Protein Interactome
You are here:
Support