ACTN2 antibody (N-Term)

Catalog No. ABIN630832

This Rabbit Polyclonal antibody specifically detects ACTN2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ACTN2 antibody (N-Term) (ABIN630832)

Target: ACTN2 (Actinin, alpha 2 (ACTN2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACTN2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACTN2 Antibody

Binding Specificity: N-Term

Specificity: Alpha Actinin 2 antibody was raised against the N terminal of ACTN2

Purification: Affinity purified

Immunogen: alpha Actinin 2 antibody was raised using the N terminal of ACTN2 corresponding to a region with amino acids NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Alpha Actinin 2 Blocking Peptide, (ABIN5612031), is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACTN2

Target: ACTN2 (Actinin, alpha 2 (ACTN2))

Alternative Name: alpha Actinin 2

Background: The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres.

Molecular Weight: 104 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Skeletal Muscle Fiber Development, Negative Regulation of Transporter Activity