ACTN2 antibody (N-Term)
-
- Target See all ACTN2 Antibodies
- ACTN2 (Actinin, alpha 2 (ACTN2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACTN2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Alpha Actinin 2 antibody was raised against the N terminal of ACTN2
- Purification
- Affinity purified
- Immunogen
- alpha Actinin 2 antibody was raised using the N terminal of ACTN2 corresponding to a region with amino acids NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH
- Top Product
- Discover our top product ACTN2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Alpha Actinin 2 Blocking Peptide, catalog no. 33R-6838, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACTN2 (Actinin, alpha 2 (ACTN2))
- Alternative Name
- alpha Actinin 2 (ACTN2 Products)
- Synonyms
- MGC89234 antibody, ACTN2 antibody, 1110008F24Rik antibody, CMD1AA antibody, wu:fd44c03 antibody, zgc:123223 antibody, actinin alpha 2 antibody, actinin, alpha 2b antibody, actinin alpha 2 S homeolog antibody, actn2 antibody, ACTN2 antibody, Actn2 antibody, actn2b antibody, actn2.S antibody
- Background
- The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres.
- Molecular Weight
- 104 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Skeletal Muscle Fiber Development, Negative Regulation of Transporter Activity
-