Cytokeratin 13 antibody (N-Term)

Catalog No. ABIN630838

This Rabbit Polyclonal antibody specifically detects Cytokeratin 13 in WB. It exhibits reactivity toward Human.

Quick Overview for Cytokeratin 13 antibody (N-Term) (ABIN630838)

Target: Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cytokeratin 13 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Cytokeratin 13 Antibody

Binding Specificity: N-Term

Specificity: Cytokeratin 13 antibody was raised against the N terminal of KRT13

Purification: Affinity purified

Immunogen: Cytokeratin 13 antibody was raised using the N terminal of KRT13 corresponding to a region with amino acids TMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 13 Blocking Peptide, (ABIN5613103), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cytokeratin 13

Target: Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))

Alternative Name: Cytokeratin 13

Background: KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins.

Molecular Weight: 46 kDa (MW of target protein)