TGIF1 antibody (C-Term)

Catalog No. ABIN630855

Product Details anti-TGIF1 Antibody

Target: TGIF1 (TGFB-Induced Factor Homeobox 1 (TGIF1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TGIF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TGIF1 antibody was raised against the C terminal of TGIF1

Purification: Affinity purified

Immunogen: TGIF1 antibody was raised using the C terminal of TGIF1 corresponding to a region with amino acids GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TGIF1 Blocking Peptide, catalog no. 33R-3506, is also available for use as a blocking control in assays to test for specificity of this TGIF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGIF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TGIF1

Target: TGIF1 (TGFB-Induced Factor Homeobox 1 (TGIF1))

Alternative Name: TGIF1 (TGIF1 Products)

Synonyms: HPE4 antibody, TGIF antibody, AA959811 antibody, AI462167 antibody, Tgif antibody, Tfig antibody, fa06h05 antibody, fb33g11 antibody, zgc:55852 antibody, wu:fa06h05 antibody, wu:fb33g11 antibody, hpe4 antibody, tgif antibody, tgif1 antibody, TGFB induced factor homeobox 1 antibody, TGFB-induced factor homeobox 1 antibody, TGFB induced factor homeobox 1 S homeolog antibody, TGIF1 antibody, Tgif1 antibody, tgif1 antibody, tgif1.S antibody

Background: TGIF1 is a member of the three-amino acid loop extension (TALE) superclass of atypical homeodomains. TALE homeobox proteins are highly conserved transcription regulators. This particular homeodomain binds to a previously characterized retinoid X receptor responsive element from the cellular retinol-binding protein II promoter. In addition to its role in inhibiting 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element, the protein is an active transcriptional co-repressor of SMAD2 and may participate in the transmission of nuclear signals during development and in the adult. Mutations in this gene are associated with holoprosencephaly type 4, which is a structural anomaly of the brain.

Molecular Weight: 43 kDa (MW of target protein)

Pathways: Retinoic Acid Receptor Signaling Pathway, Chromatin Binding, Tube Formation