DCLRE1C antibody

Catalog No. ABIN630862

This Rabbit Polyclonal antibody specifically detects DCLRE1C in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for DCLRE1C antibody (ABIN630862)

Target: DCLRE1C (DNA Cross-Link Repair 1C (DCLRE1C))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DCLRE1C antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DCLRE1C Antibody

Purification: Affinity purified

Immunogen: DCLRE1 C antibody was raised using a synthetic peptide corresponding to a region with amino acids SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DCLRE1C Blocking Peptide, (ABIN5613137), is also available for use as a blocking control in assays to test for specificity of this DCLRE1C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCLRE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DCLRE1C

Target: DCLRE1C (DNA Cross-Link Repair 1C (DCLRE1C))

Alternative Name: DCLRE1C

Background: DCLRE1C is a nuclear protein that is involved in V(D)J recombination and DNA repair. The protein has single-strand-specific 5'-3' exonuclease activity, it also exhibits endonuclease activity on 5' and 3' overhangs and hairpins when complexed with protein kinase, DNA-activated, catalytic polypeptide. Mutations in this gene cause Athabascan-type severe combined immunodeficiency (SCIDA).

Molecular Weight: 78 kDa (MW of target protein)

Pathways: DNA Damage Repair