DCLRE1C antibody
-
- Target See all DCLRE1C Antibodies
- DCLRE1C (DNA Cross-Link Repair 1C (DCLRE1C))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DCLRE1C antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DCLRE1 C antibody was raised using a synthetic peptide corresponding to a region with amino acids SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRL
- Top Product
- Discover our top product DCLRE1C Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DCLRE1C Blocking Peptide, catalog no. 33R-8799, is also available for use as a blocking control in assays to test for specificity of this DCLRE1C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCLRE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DCLRE1C (DNA Cross-Link Repair 1C (DCLRE1C))
- Alternative Name
- DCLRE1C (DCLRE1C Products)
- Background
- DCLRE1C is a nuclear protein that is involved in V(D)J recombination and DNA repair. The protein has single-strand-specific 5'-3' exonuclease activity, it also exhibits endonuclease activity on 5' and 3' overhangs and hairpins when complexed with protein kinase, DNA-activated, catalytic polypeptide. Mutations in this gene cause Athabascan-type severe combined immunodeficiency (SCIDA).
- Molecular Weight
- 78 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-