NEK11 antibody

Catalog No. ABIN630865

Product Details anti-NEK11 Antibody

Target: NEK11 (NIMA (Never In Mitosis Gene A)-Related Kinase 11 (NEK11))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NEK11 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NEK11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NEK11 Blocking Peptide, catalog no. 33R-4339, is also available for use as a blocking control in assays to test for specificity of this NEK11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NEK11

Target: NEK11 (NIMA (Never In Mitosis Gene A)-Related Kinase 11 (NEK11))

Alternative Name: NEK11 (NEK11 Products)

Synonyms: nek11 antibody, MGC147549 antibody, 4932416N14Rik antibody, NIMA-related kinase 11 antibody, NIMA (never in mitosis gene a)-related expressed kinase 11 antibody, NIMA related kinase 11 antibody, nek11 antibody, Nek11 antibody, NEK11 antibody

Background: NEK11 is a member of the never in mitosis gene A family of kinases. NEK11 localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. It appears to play roles in DNA replication and response to genotoxic stress. NEK11 belongs to the NIMA family of kinases, which are involved in DNA replication and genotoxic stress responses.

Molecular Weight: 74 kDa (MW of target protein)