NMT1 antibody (N-Term)

Catalog No. ABIN630887

The Rabbit Polyclonal anti-NMT1 antibody has been validated for WB. It is suitable to detect NMT1 in samples from Human, Mouse and Rat.

Quick Overview for NMT1 antibody (N-Term) (ABIN630887)

Target: NMT1 (N-Myristoyltransferase 1 (NMT1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NMT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NMT1 Antibody

Binding Specificity: N-Term

Specificity: NMT1 antibody was raised against the N terminal of NMT1

Purification: Affinity purified

Immunogen: NMT1 antibody was raised using the N terminal of NMT1 corresponding to a region with amino acids TMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NMT1 Blocking Peptide, (ABIN5615012), is also available for use as a blocking control in assays to test for specificity of this NMT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NMT1

Target: NMT1 (N-Myristoyltransferase 1 (NMT1))

Alternative Name: NMT1

Background: Myristate, a rare 14-carbon saturated fatty acid, is cotranslationally attached by an amide linkage to the N-terminal glycine residue of cellular and viral proteins with diverse functions. N-myristoyltransferase catalyzes the transfer of myristate from CoA to proteins. N-myristoylation appears to be irreversible and is required for full expression of the biologic activities of several N-myristoylated proteins, including the alpha subunit of the signal-transducing guanine nucleotide-binding protein (G protein) GO (GNAO1).

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling