NMT1 antibody (N-Term)

Catalog No. ABIN630887

Product Details anti-NMT1 Antibody

Target: NMT1 (N-Myristoyltransferase 1 (NMT1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NMT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NMT1 antibody was raised against the N terminal of NMT1

Purification: Affinity purified

Immunogen: NMT1 antibody was raised using the N terminal of NMT1 corresponding to a region with amino acids TMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NMT1 Blocking Peptide, catalog no. 33R-9200, is also available for use as a blocking control in assays to test for specificity of this NMT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NMT1

Target: NMT1 (N-Myristoyltransferase 1 (NMT1))

Alternative Name: NMT1 (NMT1 Products)

Synonyms: NMT antibody, im:2601337 antibody, nmt1 antibody, wu:fc15d01 antibody, wu:fc18a04 antibody, zgc:110714 antibody, MGC145283 antibody, AW536594 antibody, ARABIDOPSIS THALIANA MYRISTOYL-COA:PROTEIN N-MYRISTOYLTRANSFERASE antibody, ATNMT1 antibody, MHM17.15 antibody, MHM17_15 antibody, N-MYRISTOYLTRANSFERASE 1 antibody, myristoyl-CoA:protein N-myristoyltransferase antibody, N-myristoyltransferase 1 antibody, N-myristoyltransferase 1a antibody, N-myristoyltransferase 1 L homeolog antibody, N-myristoyltransferase 1 (predicted) antibody, myristoyl-CoA:protein N-myristoyltransferase antibody, NMT1 antibody, nmt1a antibody, nmt1.L antibody, nmt1 antibody, SPBC2G2.11 antibody, Nmt1 antibody

Background: Myristate, a rare 14-carbon saturated fatty acid, is cotranslationally attached by an amide linkage to the N-terminal glycine residue of cellular and viral proteins with diverse functions. N-myristoyltransferase catalyzes the transfer of myristate from CoA to proteins. N-myristoylation appears to be irreversible and is required for full expression of the biologic activities of several N-myristoylated proteins, including the alpha subunit of the signal-transducing guanine nucleotide-binding protein (G protein) GO (GNAO1).

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling