EEF2 antibody (N-Term)

Catalog No. ABIN630891

The Rabbit Polyclonal anti-EEF2 antibody (ABIN630891) specifically detects EEF2 in WB. The antibody is reactive with Human, Mouse, Rat, Drosophila melanogaster and C. elegans samples.

Quick Overview for EEF2 antibody (N-Term) (ABIN630891)

Target: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Reactivity: Human, Mouse, Rat, Drosophila melanogaster, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EEF2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EEF2 Antibody

Binding Specificity: N-Term

Specificity: EEF2 antibody was raised against the N terminal of EEF2

Purification: Affinity purified

Immunogen: EEF2 antibody was raised using the N terminal of EEF2 corresponding to a region with amino acids TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EEF2 Blocking Peptide, (ABIN5613309), is also available for use as a blocking control in assays to test for specificity of this EEF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EEF2

Target: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Alternative Name: EEF2

Background: EEF2 is a member of the GTP-binding translation elongation factor family. The protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

Molecular Weight: 94 kDa (MW of target protein)

Pathways: AMPK Signaling