MBP antibody (Middle Region)

Catalog No. ABIN630898

This Rabbit Polyclonal antibody specifically detects MBP in WB. It exhibits reactivity toward Human.

Quick Overview for MBP antibody (Middle Region) (ABIN630898)

Target: MBP (Myelin Basic Protein (MBP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MBP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MBP Antibody

Binding Specificity: Middle Region

Specificity: MBP antibody was raised against the middle region of MBP

Purification: Affinity purified

Immunogen: MBP antibody was raised using the middle region of MBP corresponding to a region with amino acids FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MBP Blocking Peptide, (ABIN938289), is also available for use as a blocking control in assays to test for specificity of this MBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MBP

Target: MBP (Myelin Basic Protein (MBP))

Alternative Name: Myelin basic protein

Background: The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells.

Molecular Weight: 33 kDa (MW of target protein)