MBP antibody (Middle Region)
-
- Target See all MBP Antibodies
- MBP (Myelin Basic Protein (MBP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MBP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MBP antibody was raised against the middle region of MBP
- Purification
- Affinity purified
- Immunogen
- MBP antibody was raised using the middle region of MBP corresponding to a region with amino acids FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV
- Top Product
- Discover our top product MBP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MBP Blocking Peptide, catalog no. 33R-2903, is also available for use as a blocking control in assays to test for specificity of this MBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MBP (Myelin Basic Protein (MBP))
- Alternative Name
- Myelin basic protein (MBP Products)
- Synonyms
- C76307 antibody, Hmbpr antibody, R75289 antibody, golli-mbp antibody, mld antibody, shi antibody, Mbps antibody, cb274 antibody, fj33b11 antibody, mbp antibody, wu:fj33b11 antibody, wu:fq15b02 antibody, zgc:136630 antibody, MGC115135 antibody, myelin basic protein antibody, myelin basic protein a antibody, myelin basic protein L homeolog antibody, MBP antibody, Mbp antibody, mbpa antibody, mbp antibody, mbp.L antibody
- Background
- The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells.
- Molecular Weight
- 33 kDa (MW of target protein)
-