CNN2 antibody (N-Term)

Catalog No. ABIN630968

Product Details anti-CNN2 Antibody

Target: CNN2 (Calponin 2 (CNN2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CNN2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Calponin 2 antibody was raised against the N terminal of CNN2

Purification: Affinity purified

Immunogen: Calponin 2 antibody was raised using the N terminal of CNN2 corresponding to a region with amino acids MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Calponin 2 Blocking Peptide, catalog no. 33R-6515, is also available for use as a blocking control in assays to test for specificity of this Calponin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CNN2

Target: CNN2 (Calponin 2 (CNN2))

Alternative Name: Calponin 2 (CNN2 Products)

Synonyms: Calponin-2 antibody, CNN2 antibody, DKFZp468N0916 antibody, cnn2 antibody, AA408047 antibody, AI324678 antibody, Calpo2 antibody, wu:fb36d03 antibody, wu:fb93a05 antibody, wz2414 antibody, zgc:65794 antibody, MGC82320 antibody, MGC108411 antibody, calponin 2 antibody, calponin 2 L homeolog antibody, calponin 2 pseudogene antibody, CNN2 antibody, cnn2 antibody, Cnn2 antibody, cnn2.L antibody, LOC450419 antibody

Background: CNN2, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. CNN2 could play a role in smooth muscle contraction and cell adhesion.

Molecular Weight: 34 kDa (MW of target protein)