WARS2 antibody (Middle Region)

Catalog No. ABIN630987

This anti-WARS2 antibody is a Rabbit Polyclonal antibody detecting WARS2 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for WARS2 antibody (Middle Region) (ABIN630987)

Target: WARS2 (Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WARS2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-WARS2 Antibody

Binding Specificity: Middle Region

Specificity: WARS2 antibody was raised against the middle region of WARS2

Purification: Affinity purified

Immunogen: WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WARS2 Blocking Peptide, (ABIN5616987), is also available for use as a blocking control in assays to test for specificity of this WARS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WARS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WARS2

Target: WARS2 (Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2))

Alternative Name: WARS2

Background: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. WARS2 is the mitochondrial tryptophanyl-tRNA synthetase.

Molecular Weight: 24 kDa (MW of target protein)