Prohibitin 2 antibody (C-Term)

Catalog No. ABIN630990

Product Details anti-Prohibitin 2 Antibody

Target: Prohibitin 2 (PHB2)

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Prohibitin 2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Prohibitin 2 antibody was raised against the C terminal of PHB2

Purification: Affinity purified

Immunogen: Prohibitin 2 antibody was raised using the C terminal of PHB2 corresponding to a region with amino acids KLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Prohibitin 2 Blocking Peptide, catalog no. 33R-4533, is also available for use as a blocking control in assays to test for specificity of this Prohibitin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Prohibitin 2

Target: Prohibitin 2 (PHB2)

Alternative Name: Prohibitin 2 (PHB2 Products)

Synonyms: bcap37 antibody, zgc:73150 antibody, wu:fc28c08 antibody, PHB2 antibody, phb2 antibody, ATPHB2 antibody, F21M11.21 antibody, F21M11_21 antibody, prohibitin 2 antibody, DKFZp469N1310 antibody, BAP antibody, BCAP37 antibody, Bap37 antibody, PNAS-141 antibody, REA antibody, p22 antibody, bap37 antibody, prohibitin2 antibody, xphb2 antibody, AU044498 antibody, Bcap37 antibody, Bap antibody, Bap-37 antibody, Bcap27 antibody, prohibitin 2a antibody, prohibitin 2 antibody, prohibitin 2 S homeolog antibody, phb2a antibody, PHB2 antibody, phb2 antibody, phb2.S antibody, Phb2 antibody

Background: PHB2 acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity). It functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. PHB2 competes with NCOA1 for modulation of ER transcriptional activity. It probably involved in regulating mitochondrial respiration activity and in aging.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling