AK4 antibody (N-Term)

Catalog No. ABIN631000

This Rabbit Polyclonal antibody specifically detects AK4 in WB. It exhibits reactivity toward Human.

Quick Overview for AK4 antibody (N-Term) (ABIN631000)

Target: AK4 (Adenylate Kinase 4 (AK4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AK4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AK4 Antibody

Binding Specificity: N-Term

Specificity: AK3 L1 antibody was raised against the N terminal of AK3 1

Purification: Affinity purified

Immunogen: AK3 L1 antibody was raised using the N terminal of AK3 1 corresponding to a region with amino acids MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AK3L1 Blocking Peptide, catalog no. 33R-5749, is also available for use as a blocking control in assays to test for specificity of this AK3L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AK4

Target: AK4 (Adenylate Kinase 4 (AK4))

Alternative Name: AK3L1

Background: AK3L1 is a member of the adenylate kinase family of enzymes. The protein is localized to the mitochondrial matrix.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process