ACO2 antibody (N-Term)

Catalog No. ABIN631018

This Rabbit Polyclonal antibody specifically detects ACO2 in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for ACO2 antibody (N-Term) (ABIN631018)

Target: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACO2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACO2 Antibody

Binding Specificity: N-Term

Specificity: ACO2 antibody was raised against the N terminal of ACO2

Purification: Affinity purified

Immunogen: ACO2 antibody was raised using the N terminal of ACO2 corresponding to a region with amino acids LQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACO2 Blocking Peptide, catalog no. 33R-5311, is also available for use as a blocking control in assays to test for specificity of this ACO2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACO2

Target: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Alternative Name: ACO2

Background: ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.

Molecular Weight: 82 kDa (MW of target protein)