ACO2 antibody (N-Term)

Catalog No. ABIN631018

Product Details anti-ACO2 Antibody

Target: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACO2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACO2 antibody was raised against the N terminal of ACO2

Purification: Affinity purified

Immunogen: ACO2 antibody was raised using the N terminal of ACO2 corresponding to a region with amino acids LQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACO2 Blocking Peptide, catalog no. 33R-5311, is also available for use as a blocking control in assays to test for specificity of this ACO2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACO2

Target: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Alternative Name: ACO2 (ACO2 Products)

Synonyms: DDBDRAFT_0206187 antibody, DDBDRAFT_0230168 antibody, DDB_0206187 antibody, DDB_0230168 antibody, aconitase 2 antibody, F10M23.310 antibody, F10M23_310 antibody, ACONM antibody, ICRD antibody, Aco-2 antibody, Aco3 antibody, D10Wsu183e antibody, cb1017 antibody, wu:fa10e03 antibody, wu:fb69g04 antibody, wu:fc20c11 antibody, aconitase 2 antibody, aconitase 2 S homeolog antibody, aconitate hydratase, mitochondrial antibody, aconitase, mitochondrial antibody, mitochondrial aconitate hydratase antibody, aconitase 2, mitochondrial antibody, Probable aconitate hydratase, mitochondrial antibody, ACO2 antibody, aco2.S antibody, Bm1_07420 antibody, aco2 antibody, ach1 antibody, Aco2 antibody, aco-2 antibody

Background: ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.

Molecular Weight: 82 kDa (MW of target protein)