ALAS2 antibody (C-Term)

Catalog No. ABIN631026

This anti-ALAS2 antibody is a Rabbit Polyclonal antibody detecting ALAS2 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for ALAS2 antibody (C-Term) (ABIN631026)

Target: ALAS2 (Aminolevulinate, delta-, Synthase 2 (ALAS2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALAS2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ALAS2 Antibody

Binding Specificity: C-Term

Specificity: ALAS2 antibody was raised against the C terminal of ALAS2

Purification: Affinity purified

Immunogen: ALAS2 antibody was raised using the C terminal of ALAS2 corresponding to a region with amino acids VRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALAS2 Blocking Peptide, (ABIN5612005), is also available for use as a blocking control in assays to test for specificity of this ALAS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALAS2

Target: ALAS2 (Aminolevulinate, delta-, Synthase 2 (ALAS2))

Alternative Name: ALAS2

Background: ALAS2 specifies an erythroid-specific mitochondrially located enzyme. It catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis