MPST antibody (Middle Region)

Catalog No. ABIN631061

Product Details anti-MPST Antibody

Target: MPST (Mercaptopyruvate Sulfurtransferase (MPST))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPST antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MPST antibody was raised against the middle region of MPST

Purification: Affinity purified

Immunogen: MPST antibody was raised using the middle region of MPST corresponding to a region with amino acids DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPST Blocking Peptide, catalog no. 33R-2094, is also available for use as a blocking control in assays to test for specificity of this MPST antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPST antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPST

Target: MPST (Mercaptopyruvate Sulfurtransferase (MPST))

Alternative Name: MPST (MPST Products)

Synonyms: MST antibody, TST2 antibody, Mst antibody, mst antibody, tst antibody, tst2 antibody, fa96h11 antibody, mpst antibody, wu:fa96h11 antibody, mercaptopyruvate sulfurtransferase antibody, zgc:162544 antibody, mercaptopyruvate sulfurtransferase L homeolog antibody, mercaptopyruvate sulfurtransferase S homeolog antibody, MPST antibody, Mpst antibody, mpst antibody, zgc:162544 antibody, sseA antibody, mpst.L antibody, mpst.S antibody

Background: MPST transfer of a sulfur ion to cyanide or to other thiol compounds. MPST also has weak rhodanese activity. MPST may have a role in cyanide degradation or in thiosulfate biosynthesis.

Molecular Weight: 33 kDa (MW of target protein)