ACADL antibody (Middle Region)
-
- Target See all ACADL Antibodies
- ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACADL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACADL antibody was raised against the middle region of ACADL
- Purification
- Affinity purified
- Immunogen
- ACADL antibody was raised using the middle region of ACADL corresponding to a region with amino acids LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL
- Top Product
- Discover our top product ACADL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACADL Blocking Peptide, catalog no. 33R-5283, is also available for use as a blocking control in assays to test for specificity of this ACADL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))
- Alternative Name
- ACADL (ACADL Products)
- Background
- ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.
- Molecular Weight
- 44 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-