ACADL antibody (Middle Region)

Catalog No. ABIN631083

This anti-ACADL antibody is a Rabbit Polyclonal antibody detecting ACADL in WB. Suitable for Human and Mouse.

Quick Overview for ACADL antibody (Middle Region) (ABIN631083)

Target: ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACADL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACADL Antibody

Binding Specificity: Middle Region

Specificity: ACADL antibody was raised against the middle region of ACADL

Purification: Affinity purified

Immunogen: ACADL antibody was raised using the middle region of ACADL corresponding to a region with amino acids LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACADL Blocking Peptide, (ABIN5611873), is also available for use as a blocking control in assays to test for specificity of this ACADL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACADL

Target: ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))

Alternative Name: ACADL

Background: ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process