Ferredoxin Reductase antibody (Middle Region)

Catalog No. ABIN631105

This Rabbit Polyclonal antibody specifically detects Ferredoxin Reductase in WB. It exhibits reactivity toward Human.

Quick Overview for Ferredoxin Reductase antibody (Middle Region) (ABIN631105)

Target: Ferredoxin Reductase (FDXR)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Ferredoxin Reductase antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Ferredoxin Reductase Antibody

Binding Specificity: Middle Region

Specificity: FDXR antibody was raised against the middle region of FDXR

Purification: Affinity purified

Immunogen: FDXR antibody was raised using the middle region of FDXR corresponding to a region with amino acids LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FDXR Blocking Peptide, (ABIN940241), is also available for use as a blocking control in assays to test for specificity of this FDXR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FDXR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Ferredoxin Reductase

Target: Ferredoxin Reductase (FDXR)

Alternative Name: FDXR

Background: FDXR is a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH.

Molecular Weight: 54 kDa (MW of target protein)