Ferredoxin Reductase antibody (Middle Region)
-
- Target See all Ferredoxin Reductase (FDXR) Antibodies
- Ferredoxin Reductase (FDXR)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Ferredoxin Reductase antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FDXR antibody was raised against the middle region of FDXR
- Purification
- Affinity purified
- Immunogen
- FDXR antibody was raised using the middle region of FDXR corresponding to a region with amino acids LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW
- Top Product
- Discover our top product FDXR Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FDXR Blocking Peptide, catalog no. 33R-4855, is also available for use as a blocking control in assays to test for specificity of this FDXR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FDXR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Ferredoxin Reductase (FDXR)
- Alternative Name
- FDXR (FDXR Products)
- Synonyms
- AR antibody, AdR antibody, FDXR antibody, PSPTO4024 antibody, ADXR antibody, fdxr antibody, ferredoxin reductase antibody, ferredoxin--NADP reductase antibody, ferredoxin--NADP reductase Fpr antibody, ferredoxin reductase L homeolog antibody, FDXR antibody, Fdxr antibody, fnr-1 antibody, fpr antibody, SPO2637 antibody, fdxr.L antibody
- Background
- FDXR is a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH.
- Molecular Weight
- 54 kDa (MW of target protein)
-