Ferredoxin Reductase antibody (Middle Region)

Catalog No. ABIN631105

Product Details anti-Ferredoxin Reductase Antibody

Target: Ferredoxin Reductase (FDXR)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Ferredoxin Reductase antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FDXR antibody was raised against the middle region of FDXR

Purification: Affinity purified

Immunogen: FDXR antibody was raised using the middle region of FDXR corresponding to a region with amino acids LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FDXR Blocking Peptide, catalog no. 33R-4855, is also available for use as a blocking control in assays to test for specificity of this FDXR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FDXR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Ferredoxin Reductase

Target: Ferredoxin Reductase (FDXR)

Alternative Name: FDXR (FDXR Products)

Synonyms: AR antibody, AdR antibody, FDXR antibody, PSPTO4024 antibody, ADXR antibody, fdxr antibody, ferredoxin reductase antibody, ferredoxin--NADP reductase antibody, ferredoxin--NADP reductase Fpr antibody, ferredoxin reductase L homeolog antibody, FDXR antibody, Fdxr antibody, fnr-1 antibody, fpr antibody, SPO2637 antibody, fdxr.L antibody

Background: FDXR is a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH.

Molecular Weight: 54 kDa (MW of target protein)