HPD antibody (Middle Region)

Catalog No. ABIN631126

Product Details anti-HPD Antibody

Target: HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HPD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HPD antibody was raised against the middle region of HPD

Purification: Affinity purified

Immunogen: HPD antibody was raised using the middle region of HPD corresponding to a region with amino acids EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HPD Blocking Peptide, catalog no. 33R-2584, is also available for use as a blocking control in assays to test for specificity of this HPD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HPD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HPD

Target: HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))

Alternative Name: HPD (HPD Products)

Synonyms: fb58f02 antibody, hpd antibody, wu:fb58f02 antibody, zgc:56326 antibody, zgc:92456 antibody, MGC146689 antibody, BA0240 antibody, PSPTO3553 antibody, DDBDRAFT_0203373 antibody, DDBDRAFT_0231603 antibody, DDBDRAFT_0231604 antibody, DDB_0203373 antibody, DDB_0231603 antibody, DDB_0231604 antibody, hppd antibody, 4-HPPD antibody, 4HPPD antibody, GLOD3 antibody, HPPDASE antibody, PPD antibody, 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE antibody, F12K11.9 antibody, F12K11_9 antibody, HPD antibody, P-HYDROXYPHENYLPYRUVATE DIOXYGENASE antibody, phytoene desaturation 1 antibody, Fla antibody, Flp antibody, Hppd antibody, Laf antibody, 4-hydroxyphenylpyruvate dioxygenase a antibody, 4-hydroxyphenylpyruvate dioxygenase antibody, 4-hydroxyphenylpyruvate dioxygenase b antibody, 4-hydroxyphenylpyruvate dioxygenase L homeolog antibody, 4-hydroxyphenylpyruvic acid dioxygenase antibody, hpda antibody, HPD antibody, hpdb antibody, hpd.L antibody, hpd antibody, BA_0240 antibody, hppD antibody, Hpd antibody, PDS1 antibody

Background: The protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate. Defects in this gene are a cause of tyrosinemia type 3 (TYRO3) and hawkinsinuria.

Molecular Weight: 45 kDa (MW of target protein)