Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

phosphorylase, Glycogen, Brain (GPBB) (N-Term) antibody Primary Antibody

GPBB Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN631127
$672.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    phosphorylase, Glycogen, Brain (GPBB)
    Binding Specificity
    • 16
    • 9
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term
    Reactivity
    • 65
    • 45
    • 26
    • 4
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 67
    • 16
    • 1
    Rabbit
    Clonality
    • 68
    • 16
    Polyclonal
    Conjugate
    • 37
    • 10
    • 8
    • 7
    • 3
    • 3
    • 3
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Un-conjugated
    Application
    • 63
    • 50
    • 14
    • 13
    • 6
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Specificity
    PYGB antibody was raised against the N terminal of PYGB
    Purification
    Affinity purified
    Immunogen
    PYGB antibody was raised using the N terminal of PYGB corresponding to a region with amino acids QQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDLE
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    PYGB Blocking Peptide, catalog no. 33R-7693, is also available for use as a blocking control in assays to test for specificity of this PYGB antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYGB antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    phosphorylase, Glycogen, Brain (GPBB)
    Alternative Name
    PYGB (GPBB Antibody Abstract)
    Synonyms
    GPBB, GLYPHOA, glycogen phosphorylase B, phosphorylase, glycogen; brain, brain glycogen phosphorylase, phosphorylase, glycogen; brain S homeolog, PYGB, pygb, Pygb, pygb.S
    Background
    PYGB is a glycogen phosphorylase found predominantly in the brain. It forms homodimers which can associate into homotetramers, the enzymatically active form of glycogen phosphorylase. The activity of this enzyme is positively regulated by AMP and negatively regulated by ATP, ADP, and glucose-6-phosphate. This enzyme catalyzes the rate-determining step in glycogen degradation.
    Molecular Weight
    97 kDa (MW of target protein)
    Pathways
    Cellular Glucan Metabolic Process
You are here:
help Support