SNRK antibody (Middle Region)

Catalog No. ABIN631138

This Rabbit Polyclonal antibody specifically detects SNRK in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for SNRK antibody (Middle Region) (ABIN631138)

Target: SNRK (SNF Related Kinase (SNRK))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRK antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SNRK Antibody

Binding Specificity: Middle Region

Specificity: SNRK antibody was raised against the middle region of SNRK

Purification: Affinity purified

Immunogen: SNRK antibody was raised using the middle region of SNRK corresponding to a region with amino acids SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRK Blocking Peptide, (ABIN5616319), is also available for use as a blocking control in assays to test for specificity of this SNRK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRK

Target: SNRK (SNF Related Kinase (SNRK))

Alternative Name: SNRK

Background: SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.

Molecular Weight: 84 kDa (MW of target protein)