SNAP23 antibody (N-Term)

Catalog No. ABIN631139

The Rabbit Polyclonal anti-SNAP23 antibody has been validated for WB. It is suitable to detect SNAP23 in samples from Human.

Quick Overview for SNAP23 antibody (N-Term) (ABIN631139)

Target: SNAP23 (Synaptosomal-Associated Protein, 23kDa (SNAP23))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNAP23 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SNAP23 Antibody

Binding Specificity: N-Term

Specificity: SNAP23 antibody was raised against the N terminal of SNAP23

Purification: Affinity purified

Immunogen: SNAP23 antibody was raised using the N terminal of SNAP23 corresponding to a region with amino acids GIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNAP23 Blocking Peptide, (ABIN938718), is also available for use as a blocking control in assays to test for specificity of this SNAP23 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNAP23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNAP23

Target: SNAP23 (Synaptosomal-Associated Protein, 23kDa (SNAP23))

Alternative Name: SNAP23

Background: SNAP23 is structurally and functionally similar to SNAP25 and binds tightly to multiple syntaxins and synaptobrevins/VAMPs. It is an essential component of the high affinity receptor for the general membrane fusion machinery and is an important regulator of transport vesicle docking and fusion. Two alternative transcript variants encoding different protein isoforms have been described for this genepecificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin.

Molecular Weight: 23 kDa (MW of target protein)