A2BP1 antibody (N-Term)

Catalog No. ABIN631141

Product Details anti-A2BP1 Antibody

Target: A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This A2BP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: A2 BP1 antibody was raised against the N terminal of A2 P1

Purification: Affinity purified

Immunogen: A2 BP1 antibody was raised using the N terminal of A2 P1 corresponding to a region with amino acids NCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

A2BP1 Blocking Peptide, catalog no. 33R-6652, is also available for use as a blocking control in assays to test for specificity of this A2BP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 P1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for A2BP1

Target: A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))

Alternative Name: A2BP1 (A2BP1 Products)

Synonyms: A2BP1 antibody, fox1 antibody, a2bp1 antibody, zgc:103635 antibody, 2BP1 antibody, FOX-1 antibody, FOX1 antibody, HRNBP1 antibody, A2bp antibody, A2bp1 antibody, Hrnbp1 antibody, fox-1 antibody, RNA binding protein, fox-1 homolog 1 antibody, RNA binding fox-1 homolog 1 antibody, multicopper ferroxidase antibody, RNA binding protein, fox-1 homolog (C. elegans) 1 antibody, RBFOX1 antibody, rbfox1 antibody, FOX1 antibody, Rbfox1 antibody

Background: Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been found but their full length nature has not been determined.

Molecular Weight: 40 kDa (MW of target protein)