APEH antibody (Middle Region)
-
- Target See all APEH Antibodies
- APEH (N-Acylaminoacyl-Peptide Hydrolase (APEH))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APEH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- APEH antibody was raised against the middle region of APEH
- Purification
- Affinity purified
- Immunogen
- APEH antibody was raised using the middle region of APEH corresponding to a region with amino acids GSTGFGQDSILSLPGNVGHQDVKDVQFAVEQVLQEEHFDASHVALMGGSH
- Top Product
- Discover our top product APEH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
APEH Blocking Peptide, catalog no. 33R-3590, is also available for use as a blocking control in assays to test for specificity of this APEH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APEH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APEH (N-Acylaminoacyl-Peptide Hydrolase (APEH))
- Alternative Name
- APEH (APEH Products)
- Background
- APEH is the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.
- Molecular Weight
- 81 kDa (MW of target protein)
-