APEH antibody (Middle Region)

Catalog No. ABIN631155

Product Details anti-APEH Antibody

Target: APEH (N-Acylaminoacyl-Peptide Hydrolase (APEH))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APEH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: APEH antibody was raised against the middle region of APEH

Purification: Affinity purified

Immunogen: APEH antibody was raised using the middle region of APEH corresponding to a region with amino acids GSTGFGQDSILSLPGNVGHQDVKDVQFAVEQVLQEEHFDASHVALMGGSH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

APEH Blocking Peptide, catalog no. 33R-3590, is also available for use as a blocking control in assays to test for specificity of this APEH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APEH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APEH

Target: APEH (N-Acylaminoacyl-Peptide Hydrolase (APEH))

Alternative Name: APEH (APEH Products)

Background: APEH is the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.

Molecular Weight: 81 kDa (MW of target protein)