APEH antibody (N-Term)

Catalog No. ABIN631156

This Rabbit Polyclonal antibody specifically detects APEH in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for APEH antibody (N-Term) (ABIN631156)

Target: APEH (N-Acylaminoacyl-Peptide Hydrolase (APEH))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APEH antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-APEH Antibody

Binding Specificity: N-Term

Specificity: APEH antibody was raised against the N terminal of APEH

Purification: Affinity purified

Immunogen: APEH antibody was raised using the N terminal of APEH corresponding to a region with amino acids VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

APEH Blocking Peptide, (ABIN5612106), is also available for use as a blocking control in assays to test for specificity of this APEH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APEH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APEH

Target: APEH (N-Acylaminoacyl-Peptide Hydrolase (APEH))

Alternative Name: APEH

Background: APEH is the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.

Molecular Weight: 81 kDa (MW of target protein)